Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXA9 Peptide - C-terminal region

HOXA9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HOXA9, HOX1G

UniProt

P31269

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HOXA9 Rabbit Polyclonal Antibody (orb331406) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689952

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSLTDYACGSPPVDREKQPSEGAFSENNAENESGGDKPPIDPNNPAANWL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1000 μL Robotic Filter Tips for Tecan, Conductive, Sterile, 96*2 blister/pk, 2304/cs
CS0035-332212 1 Each

1000 μL Robotic Filter Tips for Tecan, Conductive, Sterile, 96*2 blister/pk, 2304/cs

Sign In for Pricing
View Details
OR52E2 Rabbit Polyclonal Antibody (HRP)
orb476984 100 µL

OR52E2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
POLR3A antibody
MBS9409506-01 0.1 mL

POLR3A antibody

Sign In for Pricing
View Details
POLR3A antibody
MBS9409506-02 5x 0.1 mL

POLR3A antibody

Sign In for Pricing
View Details
MN1 sgRNA CRISPR Lentivector (Human) (Target 3)
K1313704 1.0 µg DNA

MN1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Mouse Monoclonal VEGF-C Antibody (OTI4A1) [Alexa Fluor 532]
NBP2-74845AF532 0.1 mL

Mouse Monoclonal VEGF-C Antibody (OTI4A1) [Alexa Fluor 532]

Sign In for Pricing
View Details