Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP88 Peptide - middle region

NUP88 Peptide - middle region

Product Specifications

Product Name Alternative

NUP88

UniProt

Q99567

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUP88 Rabbit Polyclonal Antibody (orb587932) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002523

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PCVPNILVIATESGMLYHCVVLEGEEEDDHTSEKSWDSRIDLIPSLYVFE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin A10 Antibody
KC-1854-01 50 μL

Annexin A10 Antibody

Sign In for Pricing
View Details
Annexin A10 Antibody
KC-1854-02 100 µL

Annexin A10 Antibody

Sign In for Pricing
View Details
Annexin A10 Antibody
KC-1854-03 1 mL

Annexin A10 Antibody

Sign In for Pricing
View Details
SENP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D7]
TA800125AM 100 µL

SENP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D7]

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS710522 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
Recombinant Human CXCL7/NAP-2 Protein
PKSH032305-01 20 µg

Recombinant Human CXCL7/NAP-2 Protein

Sign In for Pricing
View Details