Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP88 Peptide - middle region

NUP88 Peptide - middle region

Product Specifications

Product Name Alternative

NUP88

UniProt

Q99567

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUP88 Rabbit Polyclonal Antibody (orb587932) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002523

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PCVPNILVIATESGMLYHCVVLEGEEEDDHTSEKSWDSRIDLIPSLYVFE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ramifenazone Hydrochloride Salt
TRC-R110500-50MG 50 mg

Ramifenazone Hydrochloride Salt

Sign In for Pricing
View Details
APC Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]
E-AB-F1351UE-01 25 µg

APC Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]

Sign In for Pricing
View Details
APC Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]
E-AB-F1351UE-02 100 µg

APC Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]

Sign In for Pricing
View Details
RAB14 Goat Polyclonal Antibody
AB0013-200 400 µg

RAB14 Goat Polyclonal Antibody

Sign In for Pricing
View Details
TIMP1 (C-term) Rabbit Polyclonal Antibody
AP54256PU-N 400 µL

TIMP1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FABP5 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP5-3), CF594 conjugate, 0.1mg/mL
BNC942225-100 1x 100 µL

FABP5 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP5-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details