Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFCAB6 Peptide - N-terminal region

EFCAB6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EFCAB6, DJBP, KIAA1672

UniProt

Q5THR3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EFCAB6 Rabbit Polyclonal Antibody (orb588045) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FGLKATTKINWKQFLTSFHEPQGLQVSSKGPLTKRNSINSRNESHKENII

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Asporin (ASPN) activation kit by CRISPRa
GA110293 1 Kit

Human Asporin (ASPN) activation kit by CRISPRa

Sign In for Pricing
View Details
VISTA / GI24 (Negative Regulator of Immune Response) (VISTA/2865), CF647 conjugate, 0.1mg/mL
BNC472865-100 1x 100 µL

VISTA / GI24 (Negative Regulator of Immune Response) (VISTA/2865), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
5/6-TAMRA-PEG3-Azide
TRC-T006225-10MG 10 mg

5/6-TAMRA-PEG3-Azide

Sign In for Pricing
View Details
N-[4-[3-(2,6-Diamino-1,4-dihydro-4-oxo-5-pyrimidinyl)-3-oxopropyl]benzoic Acid
TRC-D416305-50MG 50 mg

N-[4-[3-(2,6-Diamino-1,4-dihydro-4-oxo-5-pyrimidinyl)-3-oxopropyl]benzoic Acid

Sign In for Pricing
View Details
hnRNP A2B1 (HNRNPA2B1) (NM_002137) Human Recombinant Protein
TP319318L 1 mg

hnRNP A2B1 (HNRNPA2B1) (NM_002137) Human Recombinant Protein

Sign In for Pricing
View Details
5-Hydroxypentanoic Acid Sodium Salt
TRC-H950983-500MG 500 mg

5-Hydroxypentanoic Acid Sodium Salt

Sign In for Pricing
View Details