Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFCAB6 Peptide - N-terminal region

EFCAB6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EFCAB6, DJBP, KIAA1672

UniProt

Q5THR3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EFCAB6 Rabbit Polyclonal Antibody (orb588045) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FGLKATTKINWKQFLTSFHEPQGLQVSSKGPLTKRNSINSRNESHKENII

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin Conjugated Goat Polyclonal Antibody to Human a-2-Macroglobulin
BAT-2117-2 2 mL

Biotin Conjugated Goat Polyclonal Antibody to Human a-2-Macroglobulin

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: sigmoid
CS501660 5x 5 µm

Frozen Tissue Sections, Colon: sigmoid

Sign In for Pricing
View Details
L-Dihydroorotic acid
TRC-D451530-1G 1 g

L-Dihydroorotic acid

Sign In for Pricing
View Details
RAD51 Antibody
KC-1635-01 50 μL

RAD51 Antibody

Sign In for Pricing
View Details
RAD51 Antibody
KC-1635-02 100 µL

RAD51 Antibody

Sign In for Pricing
View Details
RAD51 Antibody
KC-1635-03 1 mL

RAD51 Antibody

Sign In for Pricing
View Details