ACOX2 Peptide - C-terminal region
ACOX2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ACOX2
UniProt
Q99424
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ACOX2 Rabbit Polyclonal Antibody (orb331426) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_005265562
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DQCLNSALGCYDGNVYERLFQWAQKSPTNTQENPAYEEYIRPLLQSWRSK
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb494330 100 µL
Guanylyl Cyclase alpha 2 Rabbit Polyclonal Antibody (PE)
Sign In for Pricing
View Details 041362-FITC 200 µL
S13A5, ID (SLC13A5, NACT, Solute carrier family 13 member 5, Na (+) /citrate cotransporter, Sodium-coupled citrate transporter, Sodium-dependent citrate transporter) (FITC) discontinued
Sign In for Pricing
View Details MBS9005486 Inquire
Rabbit anti-Rattus norvegicus (Rat) Sirt3 Polyclonal Antibody
Sign In for Pricing
View Details