ACOX2 Peptide - C-terminal region
ACOX2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ACOX2
UniProt
Q99424
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ACOX2 Rabbit Polyclonal Antibody (orb331426) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_005265562
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DQCLNSALGCYDGNVYERLFQWAQKSPTNTQENPAYEEYIRPLLQSWRSK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TA378157 100 µL
Lipolysis Stimulated Lipoprotein Receptor (LSR) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
MBS6134172-01 0.1 mL
TFAP2C (Transcription Factor AP-2 gamma, AP2-gamma, Activating Enhancer-binding Protein 2 gamma, Transcription Factor ERF-1) (AP)
Sign In for Pricing
View Details