Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH1A1 Peptide - C-terminal region

ALDH1A1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ALDH1A1, ALDC, ALDH1, PUMB1

UniProt

P00352

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALDH1A1 Rabbit Polyclonal Antibody (orb588065) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005251857

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Kluyveri rimM Protein (aa 1-162)
VAng-Lsx9704-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Kluyveri rimM Protein (aa 1-162)

Sign In for Pricing
View Details
Hepatitis B Core Antigen (HBcAg) (Biotin)
MBS6248990-01 0.1 mL

Hepatitis B Core Antigen (HBcAg) (Biotin)

Sign In for Pricing
View Details
Hepatitis B Core Antigen (HBcAg) (Biotin)
MBS6248990-02 5x 0.1 mL

Hepatitis B Core Antigen (HBcAg) (Biotin)

Sign In for Pricing
View Details
1- (2-Pyridylazo) -2-naphthol
OR79324 1 g

1- (2-Pyridylazo) -2-naphthol

Sign In for Pricing
View Details
Asb18 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3051008 1.0 µg DNA

Asb18 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
SERPINH1 (C-Term) Rabbit pAb
MBS8554951-01 0.1 mL

SERPINH1 (C-Term) Rabbit pAb

Sign In for Pricing
View Details