Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH1A1 Peptide - C-terminal region

ALDH1A1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ALDH1A1, ALDC, ALDH1, PUMB1

UniProt

P00352

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALDH1A1 Rabbit Polyclonal Antibody (orb588065) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005251857

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cog3 3'UTR Lenti-reporter-Luc Vector
16540086 1.0 µg

Cog3 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Profilin 1 (PFN1) (NM_005022) Human Tagged ORF Clone
RG202338 10 µg

Profilin 1 (PFN1) (NM_005022) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Clostridium Thermocellum Cthe_1420 Protein (aa 1-198)
VAng-Lsx01911-inquire Inquire

Recombinant Clostridium Thermocellum Cthe_1420 Protein (aa 1-198)

Sign In for Pricing
View Details
MKNK1 Protein Vector (Human) (pPM-C-HA)
PV100408 500 ng

MKNK1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
CDK6 Rabbit mAb
AB102258 100 µL

CDK6 Rabbit mAb

Sign In for Pricing
View Details
Phospho-NRP1 (Thr916) Rabbit pAb
E47R5519 100 µL

Phospho-NRP1 (Thr916) Rabbit pAb

Sign In for Pricing
View Details