CXCR5 Peptide - N-terminal region
CXCR5 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CXCR5, BLR1, MDR15
UniProt
P32302
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CXCR5 Rabbit Polyclonal Antibody (orb588089) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVFVPVAYSLIFL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681003-100 1x 100 µL
Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040304-100 1x 100 µL
CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942216-500 1x 500 µL
CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941951-100 1x 100 µL
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1951R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882597-500 1x 500 µL
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2597), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040889-100 1x 100 µL
PLAP (Placental Alkaline Phosphatase) (PL8-F6), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details