Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELF5 Peptide - C-terminal region

ELF5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ELF5, ESE2

UniProt

Q9UKW6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ELF5 Rabbit Polyclonal Antibody (orb331438) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_938195

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SEALAKMWGQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLVYKFGKNA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEACAM19 Antibody - middle region : Biotin (ARP49488_P050-Biotin)
ARP49488_P050-Biotin 100 µL

CEACAM19 Antibody - middle region : Biotin (ARP49488_P050-Biotin)

Sign In for Pricing
View Details
C-Reactive Protein (CRP, MGC88244, PTX 1, PTX1) (FITC)
C7907-04J-FITC 100 µL

C-Reactive Protein (CRP, MGC88244, PTX 1, PTX1) (FITC)

Sign In for Pricing
View Details
Midnolin Rabbit Polyclonal Antibody (BF350)
orb2556517 100 µL

Midnolin Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Laminin Alpha 1 (LAMa1)
MBS2044403-01 0.1 mL

HRP-Linked Polyclonal Antibody to Laminin Alpha 1 (LAMa1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Laminin Alpha 1 (LAMa1)
MBS2044403-02 0.2 mL

HRP-Linked Polyclonal Antibody to Laminin Alpha 1 (LAMa1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Laminin Alpha 1 (LAMa1)
MBS2044403-03 0.5 mL

HRP-Linked Polyclonal Antibody to Laminin Alpha 1 (LAMa1)

Sign In for Pricing
View Details