Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELF5 Peptide - C-terminal region

ELF5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ELF5, ESE2

UniProt

Q9UKW6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ELF5 Rabbit Polyclonal Antibody (orb331438) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_938195

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SEALAKMWGQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLVYKFGKNA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFAND5 Rabbit Polyclonal Antibody
orb575071 100 µL

ZFAND5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LOC669325 (m) -PR
sc-148912-PR 10 µM - 20 µL

LOC669325 (m) -PR

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (AE-1), 1mg/mL
BNUM0252-50 1x 50 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (AE-1), 1mg/mL

Sign In for Pricing
View Details
Mouse Monoclonal STING/TMEM173 Antibody (723505) [mFluor Violet 500 SE]
FAB7169MFV500 0.1 mL

Mouse Monoclonal STING/TMEM173 Antibody (723505) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Topoisomerase IIα (phospho-Ser1469) rabbit pAb
13473-01 50 µL

Topoisomerase IIα (phospho-Ser1469) rabbit pAb

Sign In for Pricing
View Details
Topoisomerase IIα (phospho-Ser1469) rabbit pAb
13473-02 100 µL

Topoisomerase IIα (phospho-Ser1469) rabbit pAb

Sign In for Pricing
View Details