Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXT2 Peptide - C-terminal region

EXT2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EXT2

UniProt

Q93063

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EXT2 Rabbit Polyclonal Antibody (orb331440) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997005

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTYDRVESLFRVITEVSKVPSLSKLLVVWNNQNKNPPEDSLWPKIRVPLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CA12 (NM_001218) Human Recombinant Protein
TP304810M 100 µg

CA12 (NM_001218) Human Recombinant Protein

Sign In for Pricing
View Details
Bromhexine Hydrochloride
TRC-B678600-5G 5 g

Bromhexine Hydrochloride

Sign In for Pricing
View Details
BRD1 antibody
FNab09968 100 µg

BRD1 antibody

Sign In for Pricing
View Details
ZNF521 Human Gene Knockout Kit (CRISPR)
KN417463 1 Kit

ZNF521 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS517455 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
ARK5 (NUAK1) (N-term) Rabbit Polyclonal Antibody
AP15011PU-N 400 µL

ARK5 (NUAK1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details