EYA4 Peptide - N-terminal region
EYA4 Peptide - N-terminal region
Product Specifications
Product Name Alternative
EYA4
UniProt
O95677
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EYA4 Rabbit Polyclonal Antibody (orb331441) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DTFTGSVITSSGYSPRSAHQYSPQLYPSKPYPHILSTPAAQTMSAYAGQT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942368-500 1x 500 µL
Cytokeratin 6A (KRT6A) (Basal Cell Marker) (KRT6A/2368), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![TORC2 (CRTC2) Mouse Monoclonal Antibody [Clone ID: 5B10]](https://cdn.genprice.uk/products/937/68dd189a061270361e8fc0f2/imageurl/am06534su-n.webp)
AM06534SU-N 100 µL
TORC2 (CRTC2) Mouse Monoclonal Antibody [Clone ID: 5B10]
Sign In for Pricing
View Details 
