GALNT7 Peptide - N-terminal region
GALNT7 Peptide - N-terminal region
Product Specifications
Product Name Alternative
GALNT7
UniProt
Q86SF2
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GALNT7 Rabbit Polyclonal Antibody (orb331442) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_059119
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SPLSRMREDRDVNDPMPNRGGNGLAPGEDRFKPVVPWPHVEGVEVDLESI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680253-100 1x 100 µL
Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880050-100 1x 100 µL
IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940181-500 1x 500 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941231-100 1x 100 µL
Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880646-100 1x 100 µL
Von Willebrand Factor (3E2D10 + VWF635), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC610172-500 1x 500 µL
CD45 / LCA (135-4C5), CF660R conjugate, 0.1mg/mL
Sign In for Pricing
View Details