Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAS1 Peptide - C-terminal region

GAS1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GAS1

UniProt

P54826

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GAS1 Rabbit Polyclonal Antibody (orb588103) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002039

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PICESVKENMARLCFGAELGNGPGSSGSDGGLDDYYDEDYDDEQRTGGAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Ileum
CR559701 5 µg

Tissue Total RNA, Ileum

Sign In for Pricing
View Details
Myofibroblast Marker (PR 2D3), CF647 conjugate, 0.1mg/mL
BNC473069-500 1x 500 µL

Myofibroblast Marker (PR 2D3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vmn1r226 Mouse Gene Knockout Kit (CRISPR)
KN519021 1 Kit

Vmn1r226 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Stacking platform, small 10.5"x7.5" with flat mat (3.0"separation)
B3D-STACK 1 Each

Stacking platform, small 10.5"x7.5" with flat mat (3.0"separation)

Sign In for Pricing
View Details
PPP3CB (N-term) Rabbit Polyclonal Antibody
AP15294PU-N 400 µL

PPP3CB (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
USP9X Human Gene Knockout Kit (CRISPR)
KN217531LP 1 Kit

USP9X Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details