GAS1 Peptide - C-terminal region
GAS1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
GAS1
UniProt
P54826
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GAS1 Rabbit Polyclonal Antibody (orb588103) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002039
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PICESVKENMARLCFGAELGNGPGSSGSDGGLDDYYDEDYDDEQRTGGAG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
KN400755 1 Kit
beta III TubULin (TUBB3) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 
A-1104-25 25 mL
Canavalia ensiformis Gel -Con A- Immobilized Lectin
Sign In for Pricing
View Details ![Cytokeratin 15 (KRT15) Mouse Monoclonal Antibody [Clone ID: 6E7]](https://cdn.genprice.uk/products/937/68dd189a061270361e8fbdac/imageurl/am06387su-n.webp)
AM06387SU-N 100 µL
Cytokeratin 15 (KRT15) Mouse Monoclonal Antibody [Clone ID: 6E7]
Sign In for Pricing
View Details 