GDF3 Peptide - C-terminal region
GDF3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
GDF3, UNQ222/PRO248
UniProt
Q9NR23
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GDF3 Rabbit Polyclonal Antibody (orb588104) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_065685
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DVAKDWNDNPRKNFGLFLEILVKEDRDSGVNFQPEDTCARLRCSLHASLL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RD-FMR1-Hu-01 96 Tests
Human Fragile X Mental Retardation 1 (FMR1) ELISA Kit
Sign In for Pricing
View Details RD-FMR1-Hu-02 48 Tests
Human Fragile X Mental Retardation 1 (FMR1) ELISA Kit
Sign In for Pricing
View Details 
