Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GZMH Peptide - C-terminal region

GZMH Peptide - C-terminal region

Product Specifications

Product Name Alternative

GZMH, CGL2, CTSGL2

UniProt

P20718

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GZMH Rabbit Polyclonal Antibody (orb327224) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_219491

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Tgm7 shRNA (UAS) - Lentiviral mouseTgm7 shRNA (UAS, GFP) (25)
GTR15158408 1 Vial

Lentiviral mouse Tgm7 shRNA (UAS) - Lentiviral mouseTgm7 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Prmt9 (NM_001081240) Mouse Tagged ORF Clone
MR215824 10 µg

Prmt9 (NM_001081240) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TJP1 antibody
70R-6042 100 µL

TJP1 antibody

Sign In for Pricing
View Details
IκB-β (D-3) Alexa Fluor® 546
sc-74451 AF546 200 µg/mL

IκB-β (D-3) Alexa Fluor® 546

Sign In for Pricing
View Details
Anti-NSUN6 Antibody Picoband
MBS1760119-01 0.01 mg

Anti-NSUN6 Antibody Picoband

Sign In for Pricing
View Details
Anti-NSUN6 Antibody Picoband
MBS1760119-02 0.1 mg (Carrier Free)

Anti-NSUN6 Antibody Picoband

Sign In for Pricing
View Details