Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GZMH Peptide - C-terminal region

GZMH Peptide - C-terminal region

Product Specifications

Product Name Alternative

GZMH, CGL2, CTSGL2

UniProt

P20718

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GZMH Rabbit Polyclonal Antibody (orb327224) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_219491

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-KRBOX4 Antibody
MBS8307111-01 0.03 mL

Anti-KRBOX4 Antibody

Sign In for Pricing
View Details
Anti-KRBOX4 Antibody
MBS8307111-02 0.05 mL

Anti-KRBOX4 Antibody

Sign In for Pricing
View Details
Anti-KRBOX4 Antibody
MBS8307111-03 0.1 mL

Anti-KRBOX4 Antibody

Sign In for Pricing
View Details
Anti-KRBOX4 Antibody
MBS8307111-04 0.2 mL

Anti-KRBOX4 Antibody

Sign In for Pricing
View Details
Anti-KRBOX4 Antibody
MBS8307111-05 5x 0.2 mL

Anti-KRBOX4 Antibody

Sign In for Pricing
View Details
St8sia4 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3407703 1.0 µg DNA

St8sia4 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details