Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD51 Peptide - N-terminal region

RAD51 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Name=RAD51

UniProt

Q06609

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAD51 Rabbit Polyclonal Antibody (orb573908) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ISM1 Protein Lysate (Human) with C-Ha Tag
25128031 100 µg

ISM1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Anti-POU6F1 Antibody Picoband®
A12610-1-carrier-free 100 µg/Vial

Anti-POU6F1 Antibody Picoband®

Sign In for Pricing
View Details
Recombinant Pelodictyon luteolum Argininosuccinate synthase (argG)
MBS1369223-01 0.02 mg (E-Coli)

Recombinant Pelodictyon luteolum Argininosuccinate synthase (argG)

Sign In for Pricing
View Details
Recombinant Pelodictyon luteolum Argininosuccinate synthase (argG)
MBS1369223-02 0.02 mg (Yeast)

Recombinant Pelodictyon luteolum Argininosuccinate synthase (argG)

Sign In for Pricing
View Details
Recombinant Pelodictyon luteolum Argininosuccinate synthase (argG)
MBS1369223-03 0.1 mg (E-Coli)

Recombinant Pelodictyon luteolum Argininosuccinate synthase (argG)

Sign In for Pricing
View Details
Recombinant Pelodictyon luteolum Argininosuccinate synthase (argG)
MBS1369223-04 0.1 mg (Yeast)

Recombinant Pelodictyon luteolum Argininosuccinate synthase (argG)

Sign In for Pricing
View Details