ZNF776 Peptide - middle region
ZNF776 Peptide - middle region
Product Specifications
Product Name Alternative
ZNF776
UniProt
Q68DI1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF776 Rabbit Polyclonal Antibody (orb574254) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_775903
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GECGKSFNHKCNLIQHQRVHTGERPFECTACGKLFRSNSHLKEHQRVHTG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6247077-01 0.1 mL
MUC5AC (Apomucin Major Airway GlycoProtein, Mucin 5 subtype AC tracheobronchial, Mucin 5 Subtypes A And C, Mucin 5AC oligomeric mucus/gel forming, Tracheobronchial Mucin, TBM, Mucin 5AC, Gastric Mucin) (MaxLight 750)
Sign In for Pricing
View Details MBS6247077-02 5x 0.1 mL
MUC5AC (Apomucin Major Airway GlycoProtein, Mucin 5 subtype AC tracheobronchial, Mucin 5 Subtypes A And C, Mucin 5AC oligomeric mucus/gel forming, Tracheobronchial Mucin, TBM, Mucin 5AC, Gastric Mucin) (MaxLight 750)
Sign In for Pricing
View Details 
LV782045 1.0 µg DNA
RPS3AP24 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details