Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF776 Peptide - middle region

ZNF776 Peptide - middle region

Product Specifications

Product Name Alternative

ZNF776

UniProt

Q68DI1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF776 Rabbit Polyclonal Antibody (orb574254) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775903

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GECGKSFNHKCNLIQHQRVHTGERPFECTACGKLFRSNSHLKEHQRVHTG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) LYRM1 Polyclonal Antibody
MBS7140117 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) LYRM1 Polyclonal Antibody

Sign In for Pricing
View Details
WASP antibody
20R-2741 0.05 mg

WASP antibody

Sign In for Pricing
View Details
MTSS1 discontinued
539258-01 30ul

MTSS1 discontinued

Sign In for Pricing
View Details
MTSS1 discontinued
539258-02 100 µL

MTSS1 discontinued

Sign In for Pricing
View Details
(20S) -Protopanaxatriol 5mg
A15649-5 5 mg

(20S) -Protopanaxatriol 5mg

Sign In for Pricing
View Details
Myc Tag Mouse mAb
E2620883 100 µL

Myc Tag Mouse mAb

Sign In for Pricing
View Details