Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAX6 Peptide - C-terminal region

PAX6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Name=PAX6

UniProt

P26367

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PAX6 Rabbit Polyclonal Antibody (orb329959) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005253013

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTSTGLISPGVSVPVQVPGSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken acrolein (ACR) ELISA kit
GTR10449925 96 Well

Chicken acrolein (ACR) ELISA kit

Sign In for Pricing
View Details
ST18, NT (ST18, KIAA0535, ZNF387, Suppression of tumorigenicity 18 protein, Zinc finger protein 387) (APC) discontinued
042347-APC 200 µL

ST18, NT (ST18, KIAA0535, ZNF387, Suppression of tumorigenicity 18 protein, Zinc finger protein 387) (APC) discontinued

Sign In for Pricing
View Details
LRRC15 Recombinant Rabbit mAb
ARM1794-01 30 µL

LRRC15 Recombinant Rabbit mAb

Sign In for Pricing
View Details
LRRC15 Recombinant Rabbit mAb
ARM1794-02 50 μL

LRRC15 Recombinant Rabbit mAb

Sign In for Pricing
View Details
LRRC15 Recombinant Rabbit mAb
ARM1794-03 100 µL

LRRC15 Recombinant Rabbit mAb

Sign In for Pricing
View Details
NDC80
569846-01 50 µg

NDC80

Sign In for Pricing
View Details