Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAX6 Peptide - C-terminal region

PAX6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Name=PAX6

UniProt

P26367

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PAX6 Rabbit Polyclonal Antibody (orb329959) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005253013

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTSTGLISPGVSVPVQVPGSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp207 Mouse Gene Knockout Kit (CRISPR)
KN519749 1 Kit

Zfp207 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
UGT1A7 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-20068R-BF350-TR 20 µL

UGT1A7 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Recombinant Human Repulsive guidance molecule A (RGMA)
CSB-EP836186HU-01 10 µg

Recombinant Human Repulsive guidance molecule A (RGMA)

Sign In for Pricing
View Details
Recombinant Human Repulsive guidance molecule A (RGMA)
CSB-EP836186HU-02 50 µg

Recombinant Human Repulsive guidance molecule A (RGMA)

Sign In for Pricing
View Details
Recombinant Human Repulsive guidance molecule A (RGMA)
CSB-EP836186HU-03 200 µg

Recombinant Human Repulsive guidance molecule A (RGMA)

Sign In for Pricing
View Details
Recombinant Human Repulsive guidance molecule A (RGMA)
CSB-EP836186HU-04 500 µg

Recombinant Human Repulsive guidance molecule A (RGMA)

Sign In for Pricing
View Details