Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDOB Peptide - N-terminal region

ALDOB Peptide - N-terminal region

Product Specifications

Product Name Alternative

ALDOB, ALDB

UniProt

P05062

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALDOB Rabbit Polyclonal Antibody (orb578018) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000026

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ADESVGTMGNRLQRIKVENTEENRRQFREILFSVDSSINQSIGGVILFHE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GC Polyclonal Antibody
E-AB-10680-01 20 µL

GC Polyclonal Antibody

Sign In for Pricing
View Details
GC Polyclonal Antibody
E-AB-10680-02 60 µL

GC Polyclonal Antibody

Sign In for Pricing
View Details
GC Polyclonal Antibody
E-AB-10680-03 120 µL

GC Polyclonal Antibody

Sign In for Pricing
View Details
GC Polyclonal Antibody
E-AB-10680-04 200 µL

GC Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR561643 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS506781 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details