Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDOB Peptide - N-terminal region

ALDOB Peptide - N-terminal region

Product Specifications

Product Name Alternative

ALDOB, ALDB

UniProt

P05062

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALDOB Rabbit Polyclonal Antibody (orb578018) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000026

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ADESVGTMGNRLQRIKVENTEENRRQFREILFSVDSSINQSIGGVILFHE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc16a6 Mouse Gene Knockout Kit (CRISPR)
KN515892 1 Kit

Slc16a6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ibuprofen Isopropyl Ester
TRC-I140090-1G 1 g

Ibuprofen Isopropyl Ester

Sign In for Pricing
View Details
STAT3 (NM_213662) Human Recombinant Protein
TP312394M 100 µg

STAT3 (NM_213662) Human Recombinant Protein

Sign In for Pricing
View Details
(S)-5-Tert-butoxy-4-(3-((s)-1,5-di-tert-butoxy-1,5-dioxopentan-2-yl)ureido)-5-oxopentanoic Acid
TRC-T205165-500MG 500 mg

(S)-5-Tert-butoxy-4-(3-((s)-1,5-di-tert-butoxy-1,5-dioxopentan-2-yl)ureido)-5-oxopentanoic Acid

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR562250 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
ZNF433 (NM_001080411) Human Over-expression Lysate
LC421628 20 µg

ZNF433 (NM_001080411) Human Over-expression Lysate

Sign In for Pricing
View Details