Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CGN Peptide - N-terminal region

CGN Peptide - N-terminal region

Product Specifications

Product Name Alternative

CGN, KIAA1319

UniProt

Q9P2M7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CGN Rabbit Polyclonal Antibody (orb325045) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005245422

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELPENPYSQVKGFPAPSQSSTSDEEPGAYWNGKLLRSHSQASLAGPGPVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (T-Cell Marker) (SPN/1766R), CF405S conjugate, 0.1mg/mL
BNC041766-500 1x 500 µL

CD43 (T-Cell Marker) (SPN/1766R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD163 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C1]
TA506393BM 100 µL

CD163 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C1]

Sign In for Pricing
View Details
CPEB1 Rabbit Polyclonal Antibody
ER1902-89 100 µL

CPEB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Acetoin-13C4
TRC-A163777-1MG 1 mg

Acetoin-13C4

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: left
CS632028 5x 5 µm

Frozen Tissue Sections, Colon: left

Sign In for Pricing
View Details
AHA1 (AHSA1) Mouse Monoclonal Antibody [Clone ID: OTI1D2]
CF808924 100 µg

AHA1 (AHSA1) Mouse Monoclonal Antibody [Clone ID: OTI1D2]

Sign In for Pricing
View Details