Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CGN Peptide - N-terminal region

CGN Peptide - N-terminal region

Product Specifications

Product Name Alternative

CGN, KIAA1319

UniProt

Q9P2M7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CGN Rabbit Polyclonal Antibody (orb325045) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005245422

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELPENPYSQVKGFPAPSQSSTSDEEPGAYWNGKLLRSHSQASLAGPGPVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MATH1 Recombinant Rabbit Monoclonal Antibody [JE60-25]
HA720091 100 µL

MATH1 Recombinant Rabbit Monoclonal Antibody [JE60-25]

Sign In for Pricing
View Details
LYRIC (MTDH) (NM_178812) Human Over-expression Lysate
LC403614 20 µg

LYRIC (MTDH) (NM_178812) Human Over-expression Lysate

Sign In for Pricing
View Details
FKLF / KLF11 (KLF11) (NM_001177716) Human Over-expression Lysate
LY433174 100 µg

FKLF / KLF11 (KLF11) (NM_001177716) Human Over-expression Lysate

Sign In for Pricing
View Details
Zinc Salicylate Hydrate
TRC-Z217570-5G 5 g

Zinc Salicylate Hydrate

Sign In for Pricing
View Details
HLA-DP/-DQ/-DR (MHC II) (CR3/43), CF740 conjugate, 0.1mg/mL
BNC741656-500 1x 500 µL

HLA-DP/-DQ/-DR (MHC II) (CR3/43), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-(2,3-Dihydro-1H-indol-1-yl)prop-2-en-1-one
TRC-D453013-50MG 50 mg

1-(2,3-Dihydro-1H-indol-1-yl)prop-2-en-1-one

Sign In for Pricing
View Details