Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLCO2B1 Peptide - C-terminal region

SLCO2B1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Name=SLCO2B1

UniProt

O94956

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLLVVLSQVCLSSMAAGMAIFLPKFLERQFSITASYANLLIGCLSFPSVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BLCAP 3'UTR Luciferase Stable Cell Line
TU001792 1.0 mL

BLCAP 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rapgef5 ORF Vector (Mouse) (pORF)
ORF055603 1.0 µg DNA

Rapgef5 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
mmu-miR-147-3p miRNA Mimic
MBS8301130-01 5 nmol

mmu-miR-147-3p miRNA Mimic

Sign In for Pricing
View Details
mmu-miR-147-3p miRNA Mimic
MBS8301130-02 10 nmol

mmu-miR-147-3p miRNA Mimic

Sign In for Pricing
View Details
mmu-miR-147-3p miRNA Mimic
MBS8301130-03 5x 10 nmol

mmu-miR-147-3p miRNA Mimic

Sign In for Pricing
View Details
MAGEA9 (MAGEA9B) (NM_001080790) Human Over-expression Lysate
LS728269-100ug 100 µg

MAGEA9 (MAGEA9B) (NM_001080790) Human Over-expression Lysate

Sign In for Pricing
View Details