Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLCO2B1 Peptide - C-terminal region

SLCO2B1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Name=SLCO2B1

UniProt

O94956

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLLVVLSQVCLSSMAAGMAIFLPKFLERQFSITASYANLLIGCLSFPSVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT 5a (Signal Transducer and Activator of Transcription 5a) (Biotin)
S7972-10D-Biotin 100 µL

STAT 5a (Signal Transducer and Activator of Transcription 5a) (Biotin)

Sign In for Pricing
View Details
CCR9 Rabbit pAb
APA2037-01 30 µL

CCR9 Rabbit pAb

Sign In for Pricing
View Details
CCR9 Rabbit pAb
APA2037-02 50 μL

CCR9 Rabbit pAb

Sign In for Pricing
View Details
CCR9 Rabbit pAb
APA2037-03 100 µL

CCR9 Rabbit pAb

Sign In for Pricing
View Details
Defa (Defa-rs2) (NM_007847) Mouse Tagged Lenti ORF Clone
MR221012L4 10 µg

Defa (Defa-rs2) (NM_007847) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
EIF6 Polyclonal Antibody, FITC Conjugated
A62464-050 50 µL

EIF6 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details