Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC5A8 Peptide - C-terminal region

SLC5A8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SLC5A8, AIT, SMCT, SMCT1

UniProt

Q8N695

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC5A8 Rabbit Polyclonal Antibody (orb579057) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_666018

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CNSTYNETNLMTTTEMPFTTSVFQIYNVQRTPLMDNWYSLSYLYFSTVGT

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITPR2 Antibody - N-terminal region
MBS3202419-01 0.1 mL

ITPR2 Antibody - N-terminal region

Sign In for Pricing
View Details
ITPR2 Antibody - N-terminal region
MBS3202419-02 5x 0.1 mL

ITPR2 Antibody - N-terminal region

Sign In for Pricing
View Details
MHC Class 2, I-Ak, d, b, q, r (MHC Class II) (HRP)
M3887-53-HRP 100 µL

MHC Class 2, I-Ak, d, b, q, r (MHC Class II) (HRP)

Sign In for Pricing
View Details
Porcine Endomysial Antibody IgA ELISA Kit
MBS029660-01 48 Well

Porcine Endomysial Antibody IgA ELISA Kit

Sign In for Pricing
View Details
Porcine Endomysial Antibody IgA ELISA Kit
MBS029660-02 96 Well

Porcine Endomysial Antibody IgA ELISA Kit

Sign In for Pricing
View Details
Porcine Endomysial Antibody IgA ELISA Kit
MBS029660-03 5x 96 Well

Porcine Endomysial Antibody IgA ELISA Kit

Sign In for Pricing
View Details