Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A35 Peptide - middle region

SLC25A35 Peptide - middle region

Product Specifications

Product Name Alternative

SLC25A35

UniProt

Q3KQZ1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC25A35 Rabbit Polyclonal Antibody (orb579080) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005256696

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QAASEIAVGHQYKHQGMFQALTEIGQKHGLVGLWRGALGGLPRVIVGSST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPRIP Antibody
8C16762-AAT 50 µg

MPRIP Antibody

Sign In for Pricing
View Details
(6Alpha,9Beta,11Beta)-9,11-Epoxy-6-fluoropregna-1,4,16-triene-3,20-dione
TRC-E589235-25MG 25 mg

(6Alpha,9Beta,11Beta)-9,11-Epoxy-6-fluoropregna-1,4,16-triene-3,20-dione

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung: left upper lobe
CB651612 1 Block

Frozen Tissue Blocks, Lung: left upper lobe

Sign In for Pricing
View Details
MAPT / TAU pSer356 Rabbit Polyclonal Antibody
AP01706PU-N 100 µg

MAPT / TAU pSer356 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KBTBD12 (NM_207335) Human Over-expression Lysate
LY403962 100 µg

KBTBD12 (NM_207335) Human Over-expression Lysate

Sign In for Pricing
View Details
CtIP (RBBP8) Human Gene Knockout Kit (CRISPR)
KN414904 1 Kit

CtIP (RBBP8) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details