Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A35 Peptide - middle region

SLC25A35 Peptide - middle region

Product Specifications

Product Name Alternative

SLC25A35

UniProt

Q3KQZ1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC25A35 Rabbit Polyclonal Antibody (orb579080) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005256696

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QAASEIAVGHQYKHQGMFQALTEIGQKHGLVGLWRGALGGLPRVIVGSST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human p15 INK4b (CDKN2B) activation kit by CRISPRa
GA100742 1 Kit

Human p15 INK4b (CDKN2B) activation kit by CRISPRa

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD19 Antibody[1D3]
E-AB-F09860-01 100 µg

AF/LE Purified Anti-Mouse CD19 Antibody[1D3]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD19 Antibody[1D3]
E-AB-F09860-02 1 mg

AF/LE Purified Anti-Mouse CD19 Antibody[1D3]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD19 Antibody[1D3]
E-AB-F09860-03 5 mg

AF/LE Purified Anti-Mouse CD19 Antibody[1D3]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD19 Antibody[1D3]
E-AB-F09860-04 25 mg

AF/LE Purified Anti-Mouse CD19 Antibody[1D3]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD19 Antibody[1D3]
E-AB-F09860-05 50 mg

AF/LE Purified Anti-Mouse CD19 Antibody[1D3]

Sign In for Pricing
View Details