Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGAT5 Peptide - C-terminal region

MGAT5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGAT5, GGNT5

UniProt

Q09328

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MGAT5 Rabbit Polyclonal Antibody (orb579429) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005263727

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GCAFLNPKFNPPKSSKNTDFFIGKPTLRELTSQHPYAEVFIGRPHVWTVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Stomach
CS700313 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
alpha smooth muscle Actin (ACTA2) Mouse Monoclonal Antibody [Clone ID: SPM332]
AM50166PU-T 20 µg

alpha smooth muscle Actin (ACTA2) Mouse Monoclonal Antibody [Clone ID: SPM332]

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS702732 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
ZNF449 Mouse Monoclonal Antibody [Clone ID: OTI12E10]
CF808529 100 µg

ZNF449 Mouse Monoclonal Antibody [Clone ID: OTI12E10]

Sign In for Pricing
View Details
C10-C16 Alkyl Ethoxylate Sulfuric Acid Sodium Salt
TRC-S224720-5G 5 g

C10-C16 Alkyl Ethoxylate Sulfuric Acid Sodium Salt

Sign In for Pricing
View Details
Histone H1 (AE-4), 1mg/mL
BNUM0096-50 1x 50 µL

Histone H1 (AE-4), 1mg/mL

Sign In for Pricing
View Details