MGAT5 Peptide - C-terminal region
MGAT5 Peptide - C-terminal region
Product Specifications
Product Name Alternative
MGAT5, GGNT5
UniProt
Q09328
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MGAT5 Rabbit Polyclonal Antibody (orb579429) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_005263727
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GCAFLNPKFNPPKSSKNTDFFIGKPTLRELTSQHPYAEVFIGRPHVWTVD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC882105-500 1x 500 µL
Myoglobin (Muscle Cell Marker) (MB/2105), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
AP02527PU-S 50 µL
Bim (BCL2L11) pSer69/65 Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
BNC043644-500 1x 500 µL
CD3e (T-Cell Marker) (rC3e/1931), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![PE/Cyanine7 Anti-Mouse CD8b.2 Antibody[53-5.8]](https://cdn.genprice.uk/products/763/68dd149f061270361e7d037a/imageurl/an00564h.webp)
AN00564H-01 50 Tests
PE/Cyanine7 Anti-Mouse CD8b.2 Antibody[53-5.8]
Sign In for Pricing
View Details