Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC28 Peptide - N-terminal region

DNAJC28 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DNAJC28, C21orf55, C21orf78

UniProt

Q9NX36

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAJC28 Rabbit Polyclonal Antibody (orb579576) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060303

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SADEVRESFHKLAKQYHPDSGSNTADSATFIRIEKAYRKVLSHVIEQTNA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Geobacillus Stearothermophilus Ampoule N
LA926-1X50NO 1 unit

Geobacillus Stearothermophilus Ampoule N

Sign In for Pricing
View Details
Mannitol Salt Agar (MSA) (Chapman Medium) EP/USP/ISO
4716 Pack of 30 Water Plates

Mannitol Salt Agar (MSA) (Chapman Medium) EP/USP/ISO

Sign In for Pricing
View Details
O-Nitrophenyl-b-D-Galactopyranoside
N11130 5 g

O-Nitrophenyl-b-D-Galactopyranoside

Sign In for Pricing
View Details
PE Anti-Mouse CD122 Antibody
MBS4514447-01 50 Tests

PE Anti-Mouse CD122 Antibody

Sign In for Pricing
View Details
PE Anti-Mouse CD122 Antibody
MBS4514447-02 100 Tests

PE Anti-Mouse CD122 Antibody

Sign In for Pricing
View Details
PE Anti-Mouse CD122 Antibody
MBS4514447-03 500 Tests

PE Anti-Mouse CD122 Antibody

Sign In for Pricing
View Details