Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC28 Peptide - N-terminal region

DNAJC28 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DNAJC28, C21orf55, C21orf78

UniProt

Q9NX36

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAJC28 Rabbit Polyclonal Antibody (orb579576) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060303

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SADEVRESFHKLAKQYHPDSGSNTADSATFIRIEKAYRKVLSHVIEQTNA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRP-Linked Polyclonal Antibody to Epigen (EPG)
MBS2167643-01 0.1 mL

HRP-Linked Polyclonal Antibody to Epigen (EPG)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Epigen (EPG)
MBS2167643-02 0.2 mL

HRP-Linked Polyclonal Antibody to Epigen (EPG)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Epigen (EPG)
MBS2167643-03 0.5 mL

HRP-Linked Polyclonal Antibody to Epigen (EPG)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Epigen (EPG)
MBS2167643-04 1 mL

HRP-Linked Polyclonal Antibody to Epigen (EPG)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Epigen (EPG)
MBS2167643-05 5 mL

HRP-Linked Polyclonal Antibody to Epigen (EPG)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Epigen (EPG)
MBS2167643-06 5x 5 mL

HRP-Linked Polyclonal Antibody to Epigen (EPG)

Sign In for Pricing
View Details