Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC28 Peptide - N-terminal region

DNAJC28 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DNAJC28, C21orf55, C21orf78

UniProt

Q9NX36

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAJC28 Rabbit Polyclonal Antibody (orb579576) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060303

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SADEVRESFHKLAKQYHPDSGSNTADSATFIRIEKAYRKVLSHVIEQTNA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucagon Receptor Antagonist, Control
sc-203973A 5 mg

Glucagon Receptor Antagonist, Control

Sign In for Pricing
View Details
Lentiviral mouse Dlgap4 shRNA (UAS) - Lentiviral mouse Dlgap4 shRNA (UAS, GFP) (100)
GTR15200697 1 Vial

Lentiviral mouse Dlgap4 shRNA (UAS) - Lentiviral mouse Dlgap4 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
MEK6 Rabbit Polyclonal Antibody (HRP)
orb480007 100 µL

MEK6 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
2xSuper Canace™ II High-Fidelity Mix for Library Amplification
12621ES24 24 Tests

2xSuper Canace™ II High-Fidelity Mix for Library Amplification

Sign In for Pricing
View Details
CSHL1 Antibody, FITC conjugated
CSB-PA006055LC01HU-01 50 µg

CSHL1 Antibody, FITC conjugated

Sign In for Pricing
View Details
CSHL1 Antibody, FITC conjugated
CSB-PA006055LC01HU-02 100 µg

CSHL1 Antibody, FITC conjugated

Sign In for Pricing
View Details