Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERVFRD-1 Peptide - C-terminal region

ERVFRD-1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ERVFRD-1, ERVFRDE1, UNQ6191/PRO20218

UniProt

P60508

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ERVFRD-1 Rabbit Polyclonal Antibody (orb326066) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997465

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLVSLLLLLLFGPCLLNLITQFVSSRLQAIKLQTNLSAGRHPRNIQESPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isotype Control, Mouse IgG1 Kappa (IGG1/1331), CF583R Conjugate, 0.1 mg/mL
BNC581331-1ML 1x 1 mL

Isotype Control, Mouse IgG1 Kappa (IGG1/1331), CF583R Conjugate, 0.1 mg/mL

Sign In for Pricing
View Details
1-Pentanol
TRC-P227290-10ML 10 mL

1-Pentanol

Sign In for Pricing
View Details
Geminin / DNA Replication Inhibitor (CPTC-GMMN-1), Biotin conjugate, 0.1mg/mL
BNCB2240-100 1x 100 µL

Geminin / DNA Replication Inhibitor (CPTC-GMMN-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mfsd4b1 Mouse Gene Knockout Kit (CRISPR)
KN501021 1 Kit

Mfsd4b1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Fas (TNFRSF6) associated factor 1 (CPTC-FAF1-2), CF405S conjugate, 0.1mg/mL
BNC042268-500 1x 500 µL

Fas (TNFRSF6) associated factor 1 (CPTC-FAF1-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CX3CL1 Human Gene Knockout Kit (CRISPR)
KN200420 1 Kit

CX3CL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details