Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERVFRD-1 Peptide - C-terminal region

ERVFRD-1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ERVFRD-1, ERVFRDE1, UNQ6191/PRO20218

UniProt

P60508

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ERVFRD-1 Rabbit Polyclonal Antibody (orb326066) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997465

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLVSLLLLLLFGPCLLNLITQFVSSRLQAIKLQTNLSAGRHPRNIQESPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Prostaglandin Endoperoxide Synthase 2 (PTGS2) ELISA Kit
RDR-PTGS2-Mu-01 96 Tests

Mouse Prostaglandin Endoperoxide Synthase 2 (PTGS2) ELISA Kit

Sign In for Pricing
View Details
Mouse Prostaglandin Endoperoxide Synthase 2 (PTGS2) ELISA Kit
RDR-PTGS2-Mu-02 48 Tests

Mouse Prostaglandin Endoperoxide Synthase 2 (PTGS2) ELISA Kit

Sign In for Pricing
View Details
ACTG2 Rabbit Polyclonal Antibody
TA361463 100 µL

ACTG2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2136), CF647 conjugate, 0.1mg/mL
BNC472136-500 1x 500 µL

OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2136), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EWSR1 Polyclonal Antibody
E-AB-18995-01 20 µL

EWSR1 Polyclonal Antibody

Sign In for Pricing
View Details
EWSR1 Polyclonal Antibody
E-AB-18995-02 60 µL

EWSR1 Polyclonal Antibody

Sign In for Pricing
View Details