Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINA9 Peptide - C-terminal region

SERPINA9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Name=SERPINA9

UniProt

Q86WD7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERPINA9 Rabbit Polyclonal Antibody (orb584265) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AATTTKFIVRSKDGPSYFTVSFNRTFLMMITNKATDGILFLGKVENPTKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Sprouty 4 (SPRY4) activation kit by CRISPRa
GA113132 1 Kit

Human Sprouty 4 (SPRY4) activation kit by CRISPRa

Sign In for Pricing
View Details
Moesin (MSN) Rabbit Polyclonal Antibody
AP20258PU-N 100 µg

Moesin (MSN) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DIBOA-Glucoside
TRC-D459956-5MG 5 mg

DIBOA-Glucoside

Sign In for Pricing
View Details
LEO1 Human Gene Knockout Kit (CRISPR)
KN402274 1 Kit

LEO1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SCGB3A1 Antibody
KC-39482-01 50 μL

SCGB3A1 Antibody

Sign In for Pricing
View Details
SCGB3A1 Antibody
KC-39482-02 100 µL

SCGB3A1 Antibody

Sign In for Pricing
View Details