SERPINA9 Peptide - C-terminal region
SERPINA9 Peptide - C-terminal region
Product Specifications
Product Name Alternative
Name=SERPINA9
UniProt
Q86WD7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SERPINA9 Rabbit Polyclonal Antibody (orb584265) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AATTTKFIVRSKDGPSYFTVSFNRTFLMMITNKATDGILFLGKVENPTKS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP02533PU-N 100 µL
PKC delta (PRKCD) pSer645 Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
18010-AAT 10 Gels
ProLite™ His-Tag Protein Gel Staining Kit *Green Fluorescence*
Sign In for Pricing
View Details 