Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COPS6 Peptide - C-terminal region

COPS6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Name=COPS6

UniProt

Q7L5N1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COPS6 Rabbit Polyclonal Antibody (orb584309) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006824

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LILEYVKASEAGEVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), 1mg/mL
BNUM2383-50 1x 50 µL

CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), 1mg/mL

Sign In for Pricing
View Details
Arhgap5 Mouse Gene Knockout Kit (CRISPR)
KN501515 1 Kit

Arhgap5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PNMT Mouse Monoclonal Antibody [Clone ID: AT1C11]
AM39002PU-N 100 µL

PNMT Mouse Monoclonal Antibody [Clone ID: AT1C11]

Sign In for Pricing
View Details
Human PLCXD2 activation kit by CRISPRa
GA116884 1 Kit

Human PLCXD2 activation kit by CRISPRa

Sign In for Pricing
View Details
MEF2B Human Gene Knockout Kit (CRISPR)
KN427214 1 Kit

MEF2B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS716676 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details