COPS6 Peptide - C-terminal region
COPS6 Peptide - C-terminal region
Product Specifications
Product Name Alternative
Name=COPS6
UniProt
Q7L5N1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with COPS6 Rabbit Polyclonal Antibody (orb584309) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006824
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LILEYVKASEAGEVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GA110929 1 Kit
Human Parvin alpha (PARVA) activation kit by CRISPRa
Sign In for Pricing
View Details ![Biotin Conjugated Human IFN-alpha Recombinant Rabbit Monoclonal Antibody [PS00-79] - BSA and Azide free (Detector)](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea80d88/imageurl/ha721369.webp)
HA721369 100 µL
Biotin Conjugated Human IFN-alpha Recombinant Rabbit Monoclonal Antibody [PS00-79] - BSA and Azide free (Detector)
Sign In for Pricing
View Details 
PKSV030137 100 µg
Recombinant EBOV (subtype Bundibugyo, strain Uganda 2007) GP-RBD / Glycoprotein Protein (Fc Tag)
Sign In for Pricing
View Details 
BNC400034-100 1x 100 µL
Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details