TRPT1 Peptide - C-terminal region
TRPT1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
TRPT1
UniProt
Q86TN4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TRPT1 Rabbit Polyclonal Antibody (orb326360) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GNTDGFLLPKYFKEALQLRPTRKPLSLAGDEETECQSSPKHSSRERRRIQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
KN222962LP 1 Kit
Nectin 3 (NECTIN3) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 
PKSH030808 50 µg
Recombinant Human SERPINB1/PI2 Protein (Baculovirus, His Tag)
Sign In for Pricing
View Details 