IL32 Peptide - middle region
IL32 Peptide - middle region
Product Specifications
Product Name Alternative
Name=IL32
UniProt
P24001
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IL32 Rabbit Polyclonal Antibody (orb584780) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681616-100 1x 100 µL
CD44 / HCAM Std. (BU75), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![ATP5G1 Recombinant Rabbit Monoclonal Antibody [JE64-60]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea80fb6/imageurl/ha722921.webp)
HA722921 100 µL
ATP5G1 Recombinant Rabbit Monoclonal Antibody [JE64-60]
Sign In for Pricing
View Details 