Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL32 Peptide - middle region

IL32 Peptide - middle region

Product Specifications

Product Name Alternative

Name=IL32

UniProt

P24001

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL32 Rabbit Polyclonal Antibody (orb584780) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serpini1 Mouse Gene Knockout Kit (CRISPR)
KN515610 1 Kit

Serpini1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human IGFBP1 Protein (Trx Tag)
PDEH100473-01 20 µg

Recombinant Human IGFBP1 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human IGFBP1 Protein (Trx Tag)
PDEH100473-02 100 µg

Recombinant Human IGFBP1 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human IGFBP1 Protein (Trx Tag)
PDEH100473-03 500 µg

Recombinant Human IGFBP1 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human IGFBP1 Protein (Trx Tag)
PDEH100473-04 1 mg

Recombinant Human IGFBP1 Protein (Trx Tag)

Sign In for Pricing
View Details
c-Jun (JUN) pSer243 Rabbit Polyclonal Antibody
AP02326PU-N 100 µL

c-Jun (JUN) pSer243 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details