PIP5K1A Peptide - middle region
PIP5K1A Peptide - middle region
Product Specifications
Product Name Alternative
Name=PIP5K1A
UniProt
Q99755
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PIP5K1A Rabbit Polyclonal Antibody (orb584852) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GGKNIRIVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPLPTFKDL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6358435-01 0.1 mL
TRIM45, CT (TRIM45, RNF99, Tripartite motif-containing protein 45, RING finger protein 99) (MaxLight 490)
Sign In for Pricing
View Details