Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIP5K1A Peptide - middle region

PIP5K1A Peptide - middle region

Product Specifications

Product Name Alternative

Name=PIP5K1A

UniProt

Q99755

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PIP5K1A Rabbit Polyclonal Antibody (orb584852) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGKNIRIVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPLPTFKDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIDDM1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV736216 1.0 µg DNA

NIDDM1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
CNO6L, CT (CNOT6L, CCR4B, CCR4-NOT transcription complex subunit 6-like, Carbon catabolite repressor protein 4 homolog B) (APC) discontinued
034049-APC 200 µL

CNO6L, CT (CNOT6L, CCR4B, CCR4-NOT transcription complex subunit 6-like, Carbon catabolite repressor protein 4 homolog B) (APC) discontinued

Sign In for Pricing
View Details
Anti-CCR7 Antibody [SR36-04]
ET1602-22TR 20 µL

Anti-CCR7 Antibody [SR36-04]

Sign In for Pricing
View Details
Mouse Monoclonal CEA Antibody (PARLAM 4) [Biotin]
NBP1-97718B 0.1 mL

Mouse Monoclonal CEA Antibody (PARLAM 4) [Biotin]

Sign In for Pricing
View Details
OCIAD1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-7001R-BF488 100 µL

OCIAD1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
COLQ, CT (COLQ, Acetylcholinesterase collagenic tail peptide, AChE Q subunit, Acetylcholinesterase-associated collagen) (MaxLight 750) discontinued
034101-ML750 100 µL

COLQ, CT (COLQ, Acetylcholinesterase collagenic tail peptide, AChE Q subunit, Acetylcholinesterase-associated collagen) (MaxLight 750) discontinued

Sign In for Pricing
View Details