Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGFA Peptide - C-terminal region

VEGFA Peptide - C-terminal region

Product Specifications

Product Name Alternative

Name=VEGFA

UniProt

P15692

Field of Research

Cardiovascular Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VEGFA Rabbit Polyclonal Antibody (orb584861) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHRNA10 Antibody
E93042 100 µg

CHRNA10 Antibody

Sign In for Pricing
View Details
Purified anti-mouse/rat CD62P (P-selectin)
GT05051 500 µg

Purified anti-mouse/rat CD62P (P-selectin)

Sign In for Pricing
View Details
Mob4 Mouse shRNA Lentiviral Particle (Locus ID 19070)
TL501732V 500 µL Each

Mob4 Mouse shRNA Lentiviral Particle (Locus ID 19070)

Sign In for Pricing
View Details
Biotinylated Anti-mesothelin antibody (EN071) ; Rabbit mAb
E33E100071B 100 µL

Biotinylated Anti-mesothelin antibody (EN071) ; Rabbit mAb

Sign In for Pricing
View Details
DDX50 (ATP-dependent RNA Helicase DDX50, DEAD Box Protein 50, Gu-beta, Nucleolar Protein Gu2, MGC3199) (APC)
125739-APC 100 µL

DDX50 (ATP-dependent RNA Helicase DDX50, DEAD Box Protein 50, Gu-beta, Nucleolar Protein Gu2, MGC3199) (APC)

Sign In for Pricing
View Details
TRIM21 Antibody
A52898-100UL 100 µL

TRIM21 Antibody

Sign In for Pricing
View Details